the.making.of.radin.ovir.waltz

 

 

Why is radin.ovir.waltz, the genetic.dance.for.guitar.and.orchestra part of the GIM-project*), like the fractal or DNA-based compositions difussion, chaucemar,  t.a.b.o.o, give.me.six.minutes, ginger.bread.man and p.o.i.s.o.n?

 


 


First: the music generation is based on Karposis sarcoma associated human herpes virus, called “Rhadinovirus” è see table below.

 

Second: the initial values (notes, note values) for the orchestra voices are based on the codes of the origin DNA-bases (a,c,g and t) and the related protein sequences). To get composition material, these codes were inverted, mirrored and so on.   

 

Three: and last, but not least without my head, my heart, my guitar and the sense to increase velocity and tempo of voices and distribution of the note material over the correct instruments, the composition radin.ovir.waltz, genetic.dance.for.guitar.and.orchestra, would have been never come to an end .

 

The combining of these methods results in  a completely new art of music.

 

ç HIV-Virus

 

 

 

 

Enjoy! 

 

Jovan Pesec

Wien, 31. Juli 2000 

 

 


1: AF005477. Kaposi's sarcoma-a...[gi:8714518]

LOCUS       AF005477     3638 bp    DNA             VRL       27-JUN-2000

DEFINITION  Kaposi's sarcoma-associated herpesvirus glycoprotein B gene,

            partial cds; DNA polymerase (pol) gene, complete cds; and ORF

            10-like protein gene, partial cds.

ACCESSION   AF005477 AF204169

VERSION     AF005477.2  GI:8714518

KEYWORDS    .

SOURCE      Kaposi's sarcoma-associated herpesvirus - Human herpesvirus 8.

  ORGANISM  Kaposi's sarcoma-associated herpesvirus

            Viruses; dsDNA viruses, no RNA stage; Herpesviridae;

            Gammaherpesvirinae; Rhadinovirus.

REFERENCE   1  (bases 2226 to 2701)

  AUTHORS   Rose,T.M., Strand,K.B., Schultz,E.R., Schaefer,G., Rankin,G.W. Jr.,

 

            Thouless,M.E., Tsai,C.C. and Bosch,M.L.

  TITLE     Identification of two homologs of the Kaposi's sarcoma-associated

            herpesvirus (human herpesvirus 8) in retroperitoneal fibromatosis

            of different macaque species

  JOURNAL   J. Virol. 71 (5), 4138-4144 (1997)

  MEDLINE   97248469

   PUBMED   9094697

REFERENCE   2  (bases 1 to 3638)

  AUTHORS   Schultz,E.R., Rankin,G.W. Jr., Blanc,M.P., Raden,B.W., Tsai,C.C.

            and Rose,T.M.

  TITLE     Characterization of two divergent lineages of macaque

            rhadinoviruses related to Kaposi's sarcoma-associated herpesvirus

  JOURNAL   J. Virol. 74 (10), 4919-4928 (2000)

  MEDLINE   20240083

   PUBMED   10775636

REFERENCE   3  (bases 2226 to 2701)

  AUTHORS   Rose,T.M. and Strand,K.B.

  TITLE     Direct Submission

  JOURNAL   Submitted (28-MAY-1997) Pathobiology, University of Washington, Box

            357238, Seattle, WA 98195, USA

REFERENCE   4  (bases 1 to 3638)

  AUTHORS   Rose,T.M.

  TITLE     Direct Submission

  JOURNAL   Submitted (26-JUN-2000) Pathobiology, University of Washington, Box

            357238, Seattle, WA 98195, USA

  REMARK    Sequence update by submitter

COMMENT     On Jun 26, 2000 this sequence version replaced gi:2245590.

FEATURES             Location/Qualifiers

     source          1..3638

                     /organism="Kaposi's sarcoma-associated herpesvirus"

                     /isolate="KS187"

                     /db_xref="taxon:37296"

                     /note="isolated from a KS lesion of an HIV-infected

                     individual"

     CDS             <1..328

                     /note="similar to herpesvirus saimiri ORF 8"

                     /codon_start=2

                     /product="glycoprotein B"

                     /protein_id="AAF78828.1"

                     /db_xref="GI:8714520"

                     /translation="MIIIVIAIILIIFMLSRRTNTIAQAPVKMIYPDVDRRAPPSGGA

                     PTREEIKNILLGMHQLQQEERQKADDLKKSTPSVFQRTANGLRQRLRGYKPLTQSLDI

                     SLETGE"

     gene            455..3493

                     /gene="pol"

     CDS             455..3493

                     /gene="pol"

                     /note="similar to herpesvirus saimiri ORF 9"

                     /codon_start=1

                     /product="DNA polymerase"

                     /protein_id="AAC57974.2"

                     /db_xref="GI:8714519"

                     /translation="MDFFNPFIDPTRGGPRNTVRQPTPSQSPTVPSETRVCRLIPACF

                     QTPGRPGVVAVDTTFPPTYFQGPKRGEVFAGETGSIWKTRRGQARNAPMSHLIFHVYD

                     IVETTYTADRCEDVPFSFQTDIIPSGTVLKLLGRTLDGASVCVNVFRQRCYFYTLAPQ

                     GVNLTHVLQQALQAGFGRASCGFSTEPVRKKILRAYDTQQYAVQKITLSSSPMMRTLS

                     DRLTTCGCEVFESNVDAIRRFVLDHGFSTFGWYECSNPAPRTQARDSWTELEFDCSWE

                     DLKFIPERTEWPPYSILSFDIECMGEKGFPNATQDEDMIIQISCVLHTVGNDKPYTRM

                     LLGLGTCDPLPGVEVFEFPSEYDMLAAFLSMLRDYNVEFITGYNIANFDLPYIIARAT

                     QVYDFKLQDFTKIKTGSVFEVHQPRGGSDGGNFMRSQSKVKISGIVPIDMYQVCREKL

                     SLSDYKLDTVAKQCLGRQKDDISYKDIPPLFKSGPDGRAKVGNYCVIDSVLVMDLLLR

                     FQTHVEISEIAKLAKIPTRRVLTDGQQIRVFSCLLEAAATEGYILPVPKGDAVSGYQG

                     ATVISPSPGFYDDPVLVVDFASLYPSIIQAHNLCYSTLIPGDSLHLHPHLSPDDYETF

                     VLSGGPVHFVKKHKRESLLAKLLTVWLAKRKEIRKTLASCTDPALKTILDKQQLAIKV

                     TCNAVYGFTGVASGILPCLNIAETVTLQGRKMLERSQAFVEAISPERLAGLLRRPIDV

                     SPDARFKVIYGDTDSLFICCMGFNMDSVSDFAEELASITTNTLFRSPIKLEAEKIFKC

                     LLLLTKKRYVGVLSDDKVLMKGVDLIRKTACRFVQEKSSQVLDLILREPSVKAAAKLI

                     SGQATDWVYREGLPEGFVKIIQVLNASHRELCERSVPVDKLTFTTELSRPLADYKTQN

                     LPHLTVYQKLQARQEELPQIHDRIPYVFVDAPGSLRSELAEHPEYVKQHGLRVAVDLY

                     FDKLVHAVANIIQCLFQNNTSATVAMLYNFLDIPVTFPTP"

     CDS             3611..>3638

                     /note="similar to herpesvirus saimiri ORF 10"

                     /codon_start=1

                     /product="ORF 10-like protein"

                     /protein_id="AAF78829.1"

                     /db_xref="GI:8714521"

                     /translation="MQTEATFIL"

BASE COUNT      930 a   1037 c    931 g    740 t

ORIGIN     

        1 gatgatcatt atcgttatag caatcatcct gatcattttt atgctcagtc gccgcaccaa

       61 taccatagcc caggcgccgg tgaagatgat ctaccccgac gtagatcgca gggcacctcc

      121 tagcggcgga gccccaacac gggaggaaat caaaaacatc ctgctgggaa tgcaccagct

      181 acaacaagag gagaggcaga aggcggatga tttgaaaaaa agtacaccct cggtgtttca

      241 gcgtaccgca aacggccttc gtcagcgtct gagaggatat aaacctctga ctcaatcgct

      301 agacatcagt ctggaaacgg gggagtgaca gtggattcga ggttattgtt tgatgtaaat

      361 ttaggaaaca cggcccgcct ctgaagcacc acatacagac tgcagttatc aaccctactc

      421 gttgcacaca gacacaaatt accgtccgca gatcatggat tttttcaatc catttatcga

      481 cccaactcgc ggaggcccga gaaacactgt gaggcaaccc acgccgtcac agtcgccaac

      541 tgtcccctcg gagacaagag tatgcaggct tataccggcc tgtttccaaa ccccggggcg

      601 acccggcgtg gttgccgtgg acaccacatt tccacccacc tacttccagg gccccaagcg

      661 gggagaagta ttcgcgggag agactgggtc tatctggaaa acaaggcgcg gacaggcacg

      721 caatgctcct atgtcgcacc tcatattcca cgtatacgac atcgtggaga ccacctacac

      781 ggccgaccgc tgcgaggacg tgccatttag cttccagact gatatcattc ccagcggcac

      841 cgtcctcaag ctgctcggca gaacactaga tggcgccagt gtctgcgtga acgttttcag

      901 gcagcgctgc tacttctaca cactagcacc ccagggggta aacctgaccc acgtcctcca

      961 gcaggccctc caggctggct tcggtcgcgc atcctgcggc ttctccaccg agccggtcag

     1021 aaaaaaaatc ttgcgcgcgt acgacacaca acaatatgct gtgcaaaaaa taaccctgtc

     1081 atccagtccg atgatgcgaa cgcttagcga ccgcctaaca acctgtgggt gcgaggtgtt

     1141 tgagtccaat gtggacgcca ttaggcgctt cgtgctggac cacgggttct cgacattcgg

     1201 gtggtacgag tgcagcaacc cggccccccg cacccaggcc agagactctt ggacggaact

     1261 ggagtttgac tgcagctggg aggacctaaa gtttatcccg gagaggacgg agtggccccc

     1321 atactcaatc ctatcctttg atatagaatg tatgggcgag aagggttttc ccaacgcgac

     1381 tcaagacgag gacatgatta tacaaatctc gtgtgtttta cacacagtcg gcaacgataa

     1441 accgtacacc cgcatgctac tgggcctggg gacatgcgac ccccttcctg gggtggaggt

     1501 ctttgagttt ccttcggagt acgacatgct ggccgccttc ctcagcatgc tccgcgatta

     1561 caatgtggag tttataacgg ggtacaacat agcaaacttt gaccttccat acatcatagc

     1621 ccgggcaact caggtgtacg acttcaagct gcaggacttc accaaaataa aaactgggtc

     1681 cgtgtttgag gtccaccaac ccagaggcgg ttccgatggg ggcaacttca tgaggtccca

     1741 gtcaaaggtc aaaatatcgg ggatcgtccc catagacatg taccaggttt gcagggaaaa

     1801 gctgagtctg tcagactaca agctggacac agtggctaag caatgcctcg gtcgacaaaa

     1861 agatgacatc tcatacaagg acataccccc gctttttaaa tctgggcctg atggtcgcgc

     1921 aaaggtggga aactactgtg ttattgactc ggtcctggtt atggatcttc tgctacggtt

     1981 tcagacccat gttgagatct cggaaatagc caagctggcc aagatcccca cccgtagggt

     2041 actgacggac ggccaacaga tcagggtatt ttcctgcctc ttggaggctg ctgccacgga

     2101 aggttacatt ctccccgtcc caaaaggaga cgcggttagc gggtatcagg gggccactgt

     2161 aataagcccc tctccgggat tctatgacga ccccgtactc gtggtggatt ttgccagctt

     2221 gtaccccagt atcatccaag cgcacaactt gtgctactcc acactgatac ccggcgattc

     2281 gctccacctg cacccacacc tctccccgga cgactacgaa acctttgtcc tcagcggagg

     2341 tccggtccac tttgtaaaaa aacacaaaag ggagtccctt cttgccaagc ttctgacggt

     2401 atggctcgcg aagagaaaag aaataagaaa gaccctggca tcatgcacgg accccgcact

     2461 gaaaactatt ctagacaaac aacaactggc catcaaggtt acctgcaacg ccgtttacgg

     2521 cttcacgggc gttgcctctg gcatactgcc ttgcctaaac atagcggaga ccgtgacact

     2581 acaagggcga aagatgctgg agagatctca ggcctttgta gaggccatct cgccggaacg

     2641 cctagcgggt ctcctgcgga ggccaataga cgtctcaccc gacgcccgat tcaaggtcat

     2701 atacggcgac actgactctc ttttcatatg ctgcatgggt ttcaacatgg acagcgtgtc

     2761 agacttcgcg gaggagctag cgtcaatcac caccaacacg ctgtttcgta gccccatcaa

     2821 gctggaggct gaaaagatct tcaagtgcct tctgctcctg actaaaaaga gatacgtggg

     2881 ggtactcagt gacgacaagg ttctgatgaa gggcgtagac ctcattagga aaacagcctg

     2941 tcgttttgtc caggaaaaga gcagtcaggt cctggacctc atactgcggg agccgagcgt

     3001 caaggccgcg gccaagctta tttcggggca ggcgacagac tgggtgtaca gggaagggct

     3061 cccagagggg ttcgtcaaga taattcaagt gctcaacgcg agccaccggg aactgtgcga

     3121 acgcagcgta ccagtagaca aactgacgtt taccaccgag ctaagccgcc cgctggcgga

     3181 ctacaagacg caaaacctcc cgcacctgac cgtgtaccaa aagctacaag ctagacagga

     3241 ggagcttcca cagatacacg acagaatccc ctacgtgttc gtcgacgccc caggtagcct

     3301 gcgctccgag ctggcagagc accccgagta cgtcaagcag cacggactgc gcgtggcggt

     3361 ggacctgtac ttcgacaagc tggtacacgc ggtagccaac atcatccaat gcctcttcca

     3421 gaacaacacg tcggcaaccg tagctatgtt gtataacttt ttagacattc ccgtgacttt

     3481 tcccacgccc tagtgactca gacgcggaaa cagcgcctag aaagtttcct cttgcgctat

     3541 gtgggacaac tagagtccaa cctggcaagc agtggagcaa gacgccagac agccgatctc

     3601 gaaaaaaata atgcagacag aggcaacgtt catcctag

//

 

 

 

 

DNA-Sequenz transformed into MIDI-note values (C è 65)

 

 

71 65 84 71 65 84 67 65 84 84 65 84 67 71 84 84 65 84 65 71 67 65 65 84 67 65 84 67 67 84 71 65 84 67 65 84 84 84 84 84 65 84 71 67 84 67 65 71 84 67 71 67 67 71 67 65 67 67 65 65 84 65 67 67 65 84 65 71 67 67 67 65 71 71 67 71 67 67 71 71 84 71 65 65 71 65 84 71 65 84 67 84 65 67 67 67 67 71 65 67 71 84 65 71 65 84 67 71 67 65 71 71 71 67 65 67 67 84 67 67 84 65 71 67 71 71 67 71 71 65 71 67 67 67 67 65 65 67 65 67 71 71 71 65 71 71 65 65 65 84 67 65 65 65 65 65 67 65 84 67 67 84 71 67 84 71 71 71 65 65 84 71 67 65 67 67 65 71 67 84 65 67 65 65 67 65 65 71 65 71 71 65 71 65 71 71 67 65 71 65 65 71 71 67 71 71 65 84 71 65 84 84 84 71 65 65 65 65 65 65 65 71 84 65 67 65 67 67 67 84 67 71 71 84 71 84 84 84 67 65 71 67 71 84 65 67 67 71 67 65 65 65 67 71 71 67 67 84 84 67 71 84 67 65 71 67 71 84 67 84 71 65 71 65 71 71 65 65 84 65 65 65 67 67 84 67 84 71 65 67 84 67 65 65 84 67 71 67 84 65 71 65 67 65 84 67 65 71 84 67 84 71 71 65 65 65 67 71 71 71 71 71 65 71 84 71 65 67 65 71 84 71 71 65 84 84 67 71 65 71 71 84 84 65 84 84 71 84 84 84 71 65 84 71 84 65 65 65 84 84 84 65 71 71 65 65 65 67 65 67 71 71 67 67 67 71 67 67 84 67 84 71 65 65 71 67 65 67 67 65 67 65 84 65 67 65 71 65 67 84 71 67 65 71 84 84 65 84 67 65 65 67 67 67 84 65 67 84 67 71 84 84 71 67 65 67 65 67 65 71 65 67 65 67 65 65 65 84 84 65 67 67 71 84 67 67 71 67 65 71 65 84 67 65 84 71 71 65 84 84 84 84 84 84 67 65 65 84 67 67 65 84 84 84 65 84 67 71 65 67 67 67 65 65 67 84 67 71 67 71 71 65 71 71 67 67 67 71 65 71 65 65 65 67 65 67 84 71 84 71 65 71 71 67 65 65 67 67 67 65 67 71 67 67 71 84 67 65 67 65 71 84 67 71 67 67 65 65 67 84 71 84 67 67 67 67 84 67 71 71 65 71 65 67 65 65 71 65 71 84 65 84 71 67 65 71 71 67 84 84 65 84 65 67 67 71 71 67 67 84 71 84 84 84 67 67 65 65 65 67 67 67 67 71 71 71 71 67 71 65 67 67 67 71 71 67 71 84 71 71 84 84 71 67 67 71 84 71 71 65 67 65 67 67 65 67 65 84 84 84 67 67 65 67 67 67 65 67 67 84 65 67 84 84 67 67 65 71 71 71 67 67 67 67 65 65 71 67 71 71 71 71 65 71 65 65 71 84 65 84 84 67 71 67 71 71 71 65 71 65 71 65 67 84 71 71 71 84 67 84 65 84 67 84 71 71 65 65 65 65 67 65 65 71 71 67 71 67 71 71 65 67 65 71 71 67 65 67 71 67 65 65 84 71 67 84 67 67 84 65 84 71 84 67 71 67 65 67 67 84 67 65 84 65 84 84 67 67 65 67 71 84 65 84 65 67 71 65 67 65 84 67 71 84 71 71 65 71 65 67 67 65 67 67 84 65 67 65 67 71 71 67 67 71 65 67 67 71 67 84 71 67 71 65 71 71 65 67 71 84 71 67 67 65 84 84 84 65 71 67 84 84 67 67 65 71 65 67 84 71 65 84 65 84 67 65 84 84 67 67 67 65 71 67 71 71 67 65 67 67 71 84 67 67 84 67 65 65 71 67 84 71 67 84 67 71 71 67 65 71 65 65 67 65 67 84 65 71 65 84 71 71 67 71 67 67 65 71 84 71 84 67 84 71 67 71 84 71 65 65 67 71 84 84 84 84 67 65 71 71 67 65 71 67 71 67 84 71 67 84 65 67 84 84 67 84 65 67 65 67 65 67 84 65 71 67 65 67 67 67 67 65 71 71 71 71 71 84 65 65 65 67 67 84 71 65 67 67 67 65 67 71 84 67 67 84 67 67 65 71 67 65 71 71 67 67 67 84 67 67 65 71 71 67 84 71 71 67 84 84 67 71 71 84 67 71 67 71 67 65 84 67 67 84 71 67 71 71 67 84 84 67 84 67 67 65 67 67 71 65 71 67 67 71 71 84 67 65 71 65 65 65 65 65 65 65 65 84 67 84 84 71 67 71 67 71 67 71 84 65 67 71 65 67 65 67 65 67 65 65 67 65 65 84 65 84 71 67 84 71 84 71 67 65 65 65 65 65 65 84 65 65 67 67 67 84 71 84 67 65 84 67 67 65 71 84 67 67 71 65 84 71 65 84 71 67 71 65 65 67 71 67 84 84 65 71 67 71 65 67 67 71 67 67 84 65 65 67 65 65 67 67 84 71 84 71 71 71 84 71 67 71 65 71 71 84 71 84 84 84 71 65 71 84 67 67 65 65 84 71 84 71 71 65 67 71 67 67 65 84 84 65 71 71 67 71 67 84 84 67 71 84 71 67 84 71 71 65 67 67 65 67 71 71 71 84 84 67 84 67 71 65 67 65 84 84 67 71 71 71 84 71 71 84 65 67 71 65 71 84 71 67 65 71 67 65 65 67 67 67 71 71 67 67 67 67 67 67 71 67 65 67 67 67 65 71 71 67 67 65 71 65 71 65 67 84 67 84 84 71 71 65 67 71 71 65 65 67 84 71 71 65 71 84 84 84 71 65 67 84 71 67 65 71 67 84 71 71 71 65 71 71 65 67 67 84 65 65 65 71 84 84 84 65 84 67 67 67 71 71 65 71 65 71 71 65 67 71 71 65 71 84 71 71 67 67 67 67 67 65 84 65 67 84 67 65 65 84 67 67 84 65 84 67 67 84 84 84 71 65 84 65 84 65 71 65 65 84 71 84 65 84 71 71 71 67 71 65 71 65 65 71 71 71 84 84 84 84 67 67 67 65 65 67 71 67 71 65 67 84 67 65 65 71 65 67 71 65 71 71 65 67 65 84 71 65 84 84 65 84 65 67 65 65 65 84 67 84 67 71 84 71 84 71 84 84 84 84 65 67 65 67 65 67 65 71 84 67 71 71 67 65 65 67 71 65 84 65 65 65 67 67 71 84 65 67 65 67 67 67 71 67 65 84 71 67 84 65 67 84 71 71 71 67 67 84 71 71 71 71 65 67 65 84 71 67 71 65 67 67 67 67 67 84 84 67 67 84 71 71 71 71 84 71 71 65 71 71 84 67 84 84 84 71 65 71 84 84 84 67 67 84 84 67 71 71 65 71 84 65 67 71 65 67 65 84 71 67 84 71 71 67 67 71 67 67 84 84 67 67 84 67 65 71 67 65 84 71 67 84 67 67 71 67 71 65 84 84 65 67 65 65 84 71 84 71 71 65 71 84 84 84 65 84 65 65 67 71 71 71 71 84 65 67 65 65 67 65 84 65 71 67 65 65 65 67 84 84 84 71 65 67 67 84 84 67 67 65 84 65 67 65 84 67 65 84 65 71 67 67 67 71 71 71 67 65 65 67 84 67 65 71 71 84 71 84 65 67 71 65 67 84 84 67 65 65 71 67 84 71 67 65 71 71 65 67 84 84 67 65 67 67 65 65 65 65 84 65 65 65 65 65 67 84 71 71 71 67 67 71 84 71 84 84 84 71 65 71 71 84 67 67 65 67 67 65 65 67 67 67 65 71 65 71 71 67 71 71 84 84 67 67 71 65 84 71 71 71 71 71 67 65 65 67 84 84 67 65 84 71 65 71 71 84 67 67 67 65 71 84 67 65 65 65 71 71 84 67 65 65 65 65 84 65 84 67 71 71 71 71 65 84 67 71 84 67 67 67 67 65 84 65 71 65 67 65 84 71 84 65 67 67 65 71 71 84 84 84 71 67 65 71 71 71 65 65 65 65 71 67 84 71 65 71 84 67 84 71 84 67 65 71 65 67 84 65 67 65 65 71 67 84 71 71 65 67 65 67 65 71 84 71 71 67 84 65 65 71 67 65 65 84 71 67 67 84 67 71 71 84 67 71 65 67 65 65 65 65 65 71 65 84 71 65 67 65 84 67 84 67 65 84 65 67 65 65 71 71 65 67 65 84 65 67 67 67 67 67 71 67 84 84 84 84 84 65 65 65 84 67 84 71 71 71 67 67 84 71 65 84 71 71 84 67 71 67 71 67 65 65 65 71 71 84 71 71 71 65 65 65 67 84 65 67 84 71 84 71 84 84 65 84 84 71 65 67 84 67 71 71 84 67 67 84 71 71 84 84 65 84 71 71 65 84 67 84 84 67 84 71 67 84 65 67 71 71 84 84 84 67 65 71 65 67 67 67 65 84 71 84 84 71 65 71 65 84 67 84 67 71 71 65 65 65 84 65 71 67 67 65 65 71 67 84 71 71 67 67 65 65 71 65 84 67 67 67 67 65 67 67 67 71 84 65 71 71 71 84 65 67 84 71 65 67 71 71 65 67 71 71 67 67 65 65 67 65 71 65 84 67 65 71 71 71 84 65 84 84 84 84 67 67 84 71 67 67 84 67 84 84 71 71 65 71 71 67 84 71 67 84 71 67 67 65 67 71 71 65 65 71 71 84 84 65 67 65 84 84 67 84 67 67 67 67 71 84 67 67 67 65 65 65 65 71 71 65 71 65 67 71 67 71 71 84 84 65 71 67 71 71 71 84 65 84 67 65 71 71 71 71 71 67 67 65 67 84 71 84 65 65 84 65 65 71 67 67 67 67 84 67 84 67 67 71 71 71 65 84 84 67 84 65 84 71 65 67 71 65 67 67 67 67 71 84 65 67 84 67 71 84 71 71 84 71 71 65 84 84 84 84 71 67 67 65 71 67 84 84 71 84 65 67 67 67 67 65 71 84 65 84 67 65 84 67 67 65 65 71 67 71 67 65 67 65 65 67 84 84 71 84 71 67 84 65 67 84 67 67 65 67 65 67 84 71 65 84 65 67 67 67 71 71 67 71 65 84 84 67 71 67 84 67 67 65 67 67 84 71 67 65 67 67 67 65 67 65 67 67 84 67 84 67 67 67 67 71 71 65 67 71 65 67 84 65 67 71 65 65 67 67 84 84 84 71 84 67 67 84 67 65 71 67 71 71 65 71 71 84 67 67 71 71 84 67 67 65 67 84 84 84 71 84 65 65 65 65 65 65 65 67 65 67 65 65 65 65 71 71 71 65 71 84 67 67 67 84 84 67 84 84 71 67 67 65 65 71 67 84 84 67 84 71 65 67 71 71 84 65 84 71 71 67 84 67 71 67 71 65 65 71 65 71 65 65 65 65 71 65 65 65 84 65 65 71 65 65 65 71 65 67 67 67 84 71 71 67 65 84 67 65 84 71 67 65 67 71 71 65 67 67 67 67 71 67 65 67 84 71 65 65 65 65 67 84 65 84 84 67 84 65 71 65 67 65 65 65 67 65 65 67 65 65 67 84 71 71 67 67 65 84 67 65 65 71 71 84 84 65 67 67 84 71 67 65 65 67 71 67 67 71 84 84 84 65 67 71 71 67 84 84 67 65 67 71 71 71 67 71 84 84 71 67 67 84 67 84 71 71 67 65 84 65 67 84 71 67 67 84 84 71 67 67 84 65 65 65 67 65 84 65 71 67 71 71 65 71 65 67 67 71 84 71 65 67 65 67 84 65 67 65 65 71 71 71 67 71 65 65 65 71 65 84 71 67 84 71 71 65 71 65 71 65 84 67 84 67 65 71 71 67 67 84 84 84 71 84 65 71 65 71 71 67 67 65 84 67 84 67 71 67 67 71 71 65 65 67 71 67 67 84 65 71 67 71 71 71 84 67 84 67 67 84 71 67 71 71 65 71 71 67 67 65 65 84 65 71 65 67 71 84 67 84 67 65 67 67 67 71 65 67 71 67 67 67 71 65 84 84 67 65 65 71 71 84 67 65 84 65 84 65 67 71 71 67 71 65 67 65 67 84 71 65 67 84 67 84 67 84 84 84 84 67 65 84 65 84 71 67 84 71 67 65 84 71 71 71 84 84 84 67 65 65 67 65 84 71 71 65 67 65 71 67 71 84 71 84 67 65 71 65 67 84 84 67 71 67 71 71 65 71 71 65 71 67 84 65 71 67 71 84 67 65 65 84 67 65 67 67 65 67 67 65 65 67 65 67 71 67 84 71 84 84 84 67 71 84 65 71 67 67 67 67 65 84 67 65 65 71 67 84 71 71 65 71 71 67 84 71 65 65 65 65 71 65 84 67 84 84 67 65 65 71 84 71 67 67 84 84 67 84 71 67 84 67 67 84 71 65 67 84 65 65 65 65 65 71 65 71 65 84 65 67 71 84 71 71 71 71 71 84 65 67 84 67 65 71 84 71 65 67 71 65 67 65 65 71 71 84 84 67 84 71 65 84 71 65 65 71 71 71 67 71 84 65 71 65 67 67 84 67 65 84 84 65 71 71 65 65 65 65 67 65 71 67 67 84 71 84 67 71 84 84 84 84 71 84 67 67 65 71 71 65 65 65 65 71 65 71 67 65 71 84 67 65 71 71 84 67 67 84 71 71 65 67 67 84 67 65 84 65 67 84 71 67 71 71 71 65 71 67 67 71 65 71 67 71 84 67 65 65 71 71 67 67 71 67 71 71 67 67 65 65 71 67 84 84 65 84 84 84 67 71 71 71 71 67 65 71 71 67 71 65 67 65 71 65 67 84 71 71 71 84 71 84 65 67 65 71 71 71 65 65 71 71 71 67 84 67 67 67 65 71 65 71 71 71 71 84 84 67 71 84 67 65 65 71 65 84 65 65 84 84 67 65 65 71 84 71 67 84 67 65 65 67 71 67 71 65 71 67 67 65 67 67 71 71 71 65 65 67 84 71 84 71 67 71 65 65 67 71 67 65 71 67 71 84 65 67 67 65 71 84 65 71 65 67 65 65 65 67 84 71 65 67 71 84 84 84 65 67 67 65 67 67 71 65 71 67 84 65 65 71 67 67 71 67 67 67 71 67 84 71 71 67 71 71 65 67 84 65 67 65 65 71 65 67 71 67 65 65 65 65 67 67 84 67 67 67 71 67 65 67 67 84 71 65 67 67 71 84 71 84 65 67 67 65 65 65 65 71 67 84 65 67 65 65 71 67 84 65 71 65 67 65 71 71 65 71 71 65 71 67 84 84 67 67 65 67 65 71 65 84 65 67 65 67 71 65 67 65 71 65 65 84 67 67 67 67 84 65 67 71 84 71 84 84 67 71 84 67 71 65 67 71 67 67 67 67 65 71 71 84 65 71 67 67 84 71 67 71 67 84 67 67 71 65 71 67 84 71 71 67 65 71 65 71 67 65 67 67 67 67 71 65 71 84 65 67 71 84 67 65 65 71 67 65 71 67 65 67 71 71 65 67 84 71 67 71 67 71 84 71 71 67 71 71 84 71 71 65 67 67 84 71 84 65 67 84 84 67 71 65 67 65 65 71 67 84 71 71 84 65 67 65 67 71 67 71 71 84 65 71 67 67 65 65 67 65 84 67 65 84 67 67 65 65 84 71 67 67 84 67 84 84 67 67 65 71 65 65 67 65 65 67 65 67 71 84 67 71 71 67 65 65 67 67 71 84 65 71 67 84 65 84 71 84 84 71 84 65 84 65 65 67 84 84 84 84 84 65 71 65 67 65 84 84 67 67 67 71 84 71 65 67 84 84 84 84 67 67 67 65 67 71 67 67 67 84 65 71 84 71 65 67 84 67 65 71 65 67 71 67 71 71 65 65 65 67 65 71 67 71 67 67 84 65 71 65 65 65 71 84 84 84 67 67 84 67 84 84 71 67 71 67 84 65 84 71 84 71 71 71 65 67 65 65 67 84 65 71 65 71 84 67 67 65 65 67 67 84 71 71 67 65 65 71 67 65 71 84 71 71 65 71 67 65 65 71 65 67 71 67 67 65 71 65 67 65 71 67 67 71 65 84 67 84 67 71 65 65 65 65 65 65 65 84 65 65 84 71 67 65 71 65 67 65 71 65 71 71 67 65 65 67 71 84 84 67 65 84 67 67 84 65 71